DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and AgaP_AGAP012471

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_307305.3 Gene:AgaP_AGAP012471 / 1268741 VectorBaseID:AGAP012471 Length:683 Species:Anopheles gambiae


Alignment Length:363 Identity:123/363 - (33%)
Similarity:178/363 - (49%) Gaps:60/363 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 NIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQI----------FSFDQVF 402
            :::|..||||..:||:.|.|             |::..||.......:          |:::.||
Mosquito     6 SVKVAVRIRPMSQSEQARGC-------------QTVVKQATPNFPHLLVGNGRTPWHPFAYNYVF 57

  Fly   403 HPLSSQSDIF-EMVSPLIQSALDGYNICIFAYGQTGSGKTYTM--DGVPE---SVGVIPRTVDLL 461
            .|.:.||.:: |.:||::.....|||..|.:|||..||||:||  |.:.|   :||||||.::.:
Mosquito    58 PPSALQSQVYEEAISPMLHKLFAGYNATILSYGQRSSGKTFTMGTDFIGEIDSNVGVIPRAINEI 122

  Fly   462 FDSIRGYRNLGWE-------YEIKATFLEIYNEVLYDLLSNEQKDME-----IRMAKNNKNDIYV 514
            |..|..    |.|       ..|..:|:|:|.:.:||||:....|:|     ||.|..  .:|.:
Mosquito   123 FCLIAD----GTEAAVALVDTRITCSFIEVYQDQVYDLLTENAIDIERHPVNIREAAG--GNIIL 181

  Fly   515 SNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQE---ISVGSI 576
            ..:||..|.|.......:......||:.:.|.|..|:||||:..|.:  .|..|.:   ::....
Mosquito   182 EGLTEVPVNDKQCALDCLTRGSFGRASRNPAMNNVSTRSHAIFTLTM--HHTAKDDPTMVTHSKF 244

  Fly   577 NLVDLAGSESPK----TSTRMTETKNINRSLSELTNVILAL----LQKQDHIPYRNSKLTHLLMP 633
            .:|||||||..|    :.:|..|...||:.|..|.|||.||    ...:.|||||:||||.||..
Mosquito   245 RMVDLAGSERSKKTKSSGSRFKEGVEINKCLLALGNVITALGSSVGSSKGHIPYRSSKLTRLLQD 309

  Fly   634 SLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCK 671
            ||||||.|||...|||......::..:||:|:.|.:.|
Mosquito   310 SLGGNSYTLMIACVSPTDYNLSDTYSTLRYASQVRTIK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 123/363 (34%)
KISc 348..678 CDD:214526 123/363 (34%)
AgaP_AGAP012471XP_307305.3 Motor_domain 6..347 CDD:277568 122/361 (34%)
Kinesin 12..346 CDD:278646 121/354 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.