DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncd and setx

DIOPT Version :9

Sequence 1:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_002936221.1 Gene:setx / 100145435 XenbaseID:XB-GENE-966858 Length:2535 Species:Xenopus tropicalis


Alignment Length:761 Identity:145/761 - (19%)
Similarity:241/761 - (31%) Gaps:236/761 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QTYCGNLLPPLSRDL--------NNLPQVLERRGGGARAASPEPMKLGHRAKLRRSRSACDINEL 103
            :|....|...||:.|        |:||:...|.....::.:||                      
 Frog   707 KTNLSELKSKLSKVLKKSSFKRQNSLPENTNRMDEDKKSVAPE---------------------- 749

  Fly   104 RGNKRTAAAPSLPSIP-------------SKVSRLGGALTVSSQRLVRPAAPSSITATAVKRPPV 155
            ..|....|...:.|.|             |..|....|:|...|||........:...:||..|:
 Frog   750 SNNTFLPATTYIKSEPHDPLFKQPSCNGNSSCSSDNVAVTKQLQRLSIENRVPEVQTVSVKNEPL 814

  Fly   156 TRPAPRAAGG---------AAAKKPAGTGAAASSGAAAAAPKRIAPYD------FKARFHDLLEK 205
            .......:..         .::.||......:||           |.|      |:.|       
 Frog   815 LEDRKALSKNQISALKSFERSSSKPVSEVCESSS-----------PDDDDNVPLFELR------- 861

  Fly   206 HKVLKTKYEKQTEDM--GELESMPQQLEETQNKLIETESSLKNTQSDNECLQRQVKQHTAKIETI 268
            .|:||...|:.|:..  .:|:|:..   ..|.|.::.:||......|...:||:|| .||:...|
 Frog   862 KKLLKKNKEQLTDSQVDRDLDSLSM---AAQAKFLDFDSSQSVLSQDQSPIQRKVK-GTARSPNI 922

  Fly   269 TSTLGRTKEELSELQAIHE-----------KVKTEHAA----LSTEVVHLRQRTEEL-------- 310
            .|:...|...|.::..|.:           .||:|..:    .||......:|..|.        
 Frog   923 DSSSSETDVSLDQIITISDDSEDEKKPSISSVKSEKTSPKVCPSTSTSEFSKRIAEAQIKPEPPP 987

  Fly   311 -LRCN--EQQAAELETCKEQLF----QSNMERKE-----LHNTVMDLRGNIRVFCRIRPPLE--- 360
             |.|.  :.|..|.|| ::::|    ..::::||     ||:..            .:||:.   
 Frog   988 PLTCEDYDSQFFEFET-EDEVFSVWQDPDVDQKEPVIAPLHSEA------------AKPPISDPT 1039

  Fly   361 -SEENRMCCTWTYHDE-----------STVEL------QSIDAQAKSKMGQQIFSFDQVFHPLSS 407
             ::.|.....|.|..:           ...||      :.:..:.|:|..:..||...|     |
 Frog  1040 GNDLNNEFDQWGYDTDDISDDVLEKAAEAAELSDSKPSKGLQKKPKAKGSEGTFSVKGV-----S 1099

  Fly   408 QSDIFEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVGVIPRTVDLLFDSIRGYRNLG 472
            .|..:....|:.....:..||      .|...||.::..                ..:||     
 Frog  1100 SSSFYRKDVPIAAKHKEKANI------HTSPKKTSSLSS----------------KVVRG----- 1137

  Fly   473 WEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKM 537
                 |.|...:..:::....:|..|.......:|.:.:..:.  |...|:.|..:|    .|..
 Frog  1138 -----KKTETVVAQKIISKSKANRTKSPLRSRGENVRRENLIR--TSPAVVPPKKIR----MAPE 1191

  Fly   538 NRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSI-NLVDLAGSESPKTSTRMTETKNINR 601
            ..:||...|.:::.|.    ..:|..|..:    ||..: |...:||...||    .|:.|.|:.
 Frog  1192 PSSTAEKLGFKKAPRK----AFDLSQRSLD----SVAELRNHGKMAGFVEPK----KTKAKLISP 1244

  Fly   602 SLSELTNVILALLQKQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQE---------- 656
            . |.|......:|..||...||.|:      |::.|..|     .....:|..::          
 Frog  1245 Q-SLLVKCNKKMLACQDLQFYRQSR------PNVPGKRK-----QAEALEDGNRKIENAAHKIDK 1297

  Fly   657 --SVKSLRFAASVNSCKMTKAKRNRYLNNSVAN-----SSTQSNNS 695
              :..|..|.|:.:..:....|.......|::|     |.|.||.|
 Frog  1298 NGTSSSRHFQATTSHAEAISNKPRDERKLSISNEHLEISRTSSNKS 1343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 63/359 (18%)
KISc 348..678 CDD:214526 64/363 (18%)
setxXP_002936221.1 DEXXQc_SETX 1840..2157 CDD:350800
AAA_12 2128..2323 CDD:404073
PHA03247 <2365..2534 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.