DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7789 and IMPL1

DIOPT Version :9

Sequence 1:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_564376.1 Gene:IMPL1 / 840007 AraportID:AT1G31190 Length:371 Species:Arabidopsis thaliana


Alignment Length:300 Identity:73/300 - (24%)
Similarity:119/300 - (39%) Gaps:68/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AKRAGGIIRDVLKKGDLGIVDKGKNDPQTEADRSAQRCIIASLAKKFPTVKIIGEEGGSDLNVCD 83
            ||....::.:.:.| ...|..||.:|..|:.|::::..|:..:.|.|....|:|||||       
plant    95 AKTGAEVVMEAVNK-PRNITYKGLSDLVTDTDKASEAAILEVVKKNFSDHLILGEEGG------- 151

  Fly    84 DWLVNELDEEFLQHSCPAEWKDVKPEDFVIW-VDPLDGTAEYTQGHVEHVTVLIGIAVK-DAAVG 146
              ::.:...::|                  | :||||||..:..|: ....|.:|:..: :.|..
plant   152 --IIGDSSSDYL------------------WCIDPLDGTTNFAHGY-PSFAVSVGVLYRGNPAAA 195

  Fly   147 GIIHQPFYQQPDGEMGRTIWGLKGLGTGGFTAVPAPAGQFI-ITTTRSHSNAL--------HQQA 202
            .::.  |...|.....||.....|   ||...    .||.| ::.|.:...||        |..|
plant   196 SVVE--FVGGPMCWNTRTFSATAG---GGALC----NGQKIHVSKTDAVERALLITGFGYEHDDA 251

  Fly   203 ----LNAF-----ASTEVLKVGGAGFKVLQLLEGKAHAYVFATPGCKKWDTCAPEAVLEAQGGCL 258
                :..|     .|..|.::|.|...:..:..|.|.:|  .....|.||..|...::|..||.:
plant   252 WSTNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESY--WEYRLKPWDMAAGVLIVEEAGGAV 314

  Fly   259 TNINGEHYAYNADVEHVNRQGVLASLGQDHAALVEKI-PA 297
            |.::|..::       |..:.||.|.|..|..|:|:| ||
plant   315 TRMDGGKFS-------VFDRSVLVSNGVLHPKLLERIAPA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7789NP_651728.1 IPPase 12..294 CDD:238818 69/294 (23%)
IMPL1NP_564376.1 PLN02737 11..371 CDD:215392 72/299 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.