DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7789 and IMPL2

DIOPT Version :9

Sequence 1:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_195623.3 Gene:IMPL2 / 830067 AraportID:AT4G39120 Length:375 Species:Arabidopsis thaliana


Alignment Length:307 Identity:72/307 - (23%)
Similarity:117/307 - (38%) Gaps:69/307 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RVMASSISTAKRAGGIIRDVLKKGDLGIVDKGKNDPQTEADRSAQRCIIASLAKKFPTVKIIGEE 74
            |..|...:.|..:|.:||...:| ...||||....|.|.||:.|:..:::.:.:..|:..|.|||
plant   114 RFAAVGNALADASGEVIRKYFRK-KFDIVDKDDMSPVTIADQMAEEAMVSIIFQNLPSHAIYGEE 177

  Fly    75 GGSDLNVCDDWLVNELDEEFLQHSCPAEWKDVKPEDFVIWV-DPLDGTAEYTQGHVEHVTVLIGI 138
            .|        |...|...::                  :|| ||:|||..:..|.....| ||.:
plant   178 KG--------WRCKEESADY------------------VWVLDPIDGTKSFITGKPVFGT-LIAL 215

  Fly   139 AVKDAAVGGIIHQPFYQQPDGEMGRTIW-GLKGLGTG------GFTAVPAPAGQFIITTTRSHSN 196
            ..|...:.|:|.||..::.        | |:.|..|.      ...:.|..:..::.||:   .:
plant   216 LYKGKPILGLIDQPILKER--------WIGMNGRRTKLNGEDISTRSCPKLSQAYLYTTS---PH 269

  Fly   197 ALHQQALNAFASTEVLKVGGAGFKVLQLLEGKAHAYVFA-----------TPGCKKWDTCAPEAV 250
            ...::|..|::...        .||...|.| ...|.:|           ..|.|.:|..|...|
plant   270 LFSEEAEKAYSRVR--------DKVKVPLYG-CDCYAYALLASGFVDLVIESGLKPYDFLALVPV 325

  Fly   251 LEAQGGCLTNINGEHYAYNADVEHVNRQ-GVLASLGQD-HAALVEKI 295
            :|..||.:|:..|:.:.:.|....|... .|:|:...| |...:|.:
plant   326 IEGAGGTITDWTGKRFLWEASSSAVATSFNVVAAGDSDIHQQALESL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7789NP_651728.1 IPPase 12..294 CDD:238818 70/302 (23%)
IMPL2NP_195623.3 PLN02911 80..375 CDD:178499 72/307 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.