DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7789 and CG9389

DIOPT Version :9

Sequence 1:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_649295.1 Gene:CG9389 / 40347 FlyBaseID:FBgn0037064 Length:596 Species:Drosophila melanogaster


Alignment Length:311 Identity:69/311 - (22%)
Similarity:109/311 - (35%) Gaps:83/311 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ASSIST--------AKRAGGIIRDVLKKGDLGIVDKGKNDPQTEADRSAQRCIIASLAKKFPTVK 69
            ||.:.|        .|:||.|.....||.......|..||..|..|...:...|.:::.::|..:
  Fly   273 ASDLDTLFLLACREVKKAGAIALAENKKNQEYTTKKHTNDIVTPTDNIVEESFIKAISSRYPNHQ 337

  Fly    70 IIGEEGGSD-----LNVCDD--WLVNELDEEFLQHSCPAEWKDVKPEDFVIWVDPLDGTAEYTQG 127
            .|.||..|.     :.:.||  |:                            :||:|||..:.. 
  Fly   338 FIAEERISKSETGMVTLTDDPTWI----------------------------IDPIDGTMNFVH- 373

  Fly   128 HVEHVTVLIGIAVKDAAVGGIIHQP----FY-------QQPDGEMGRTIWGLKGLGTGGFTAVPA 181
            |..:..:.:...|......|||:.|    .|       .|.:|||.||.         |.|.:.|
  Fly   374 HFPYYCISVAYLVNQETQFGIIYNPPMKNMYTAQLGKGAQMNGEMIRTT---------GQTNLSA 429

  Fly   182 PAGQFIITTTRSHSNALHQQALNAFASTEVLK------VGGAGFKVLQLLEGKAHAYVFATPGCK 240
               ..::....|.||....|.....:...|.|      :|.:...:..:..|.|.|  |...|..
  Fly   430 ---AMVLQEYSSGSNEARNQVATENSQRLVKKTHAMRSIGSSAMCLAMVASGVADA--FYNFGLH 489

  Fly   241 KWDTCAPEAVLEAQGGCLTNINGEHYAYNADVEHVNRQGVLASLGQDHAAL 291
            .||..|...::...||.:.:..||      :::.::|:.:.||  .|:.||
  Fly   490 VWDMAAGALIVTEAGGVVMDPAGE------ELDIMSRRCLAAS--TDYLAL 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7789NP_651728.1 IPPase 12..294 CDD:238818 69/311 (22%)
CG9389NP_649295.1 IMPase 279..526 CDD:238817 61/295 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.