DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7789 and CG9391

DIOPT Version :9

Sequence 1:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_649294.1 Gene:CG9391 / 40346 FlyBaseID:FBgn0037063 Length:278 Species:Drosophila melanogaster


Alignment Length:307 Identity:70/307 - (22%)
Similarity:117/307 - (38%) Gaps:70/307 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MRVMASSISTAKRAGGIIRD-------VLKKGDLGIVDKGKNDPQTEADRSAQRCIIASLAKKFP 66
            :.|.::.:|.|.|.  |.|:       |.|..|:.:|        |:.|:..::.::..:.:.||
  Fly    11 LEVASNLVSEAGRL--IARNNEQRQDFVCKSNDIDLV--------TQTDKDVEQLLMDGIRRHFP 65

  Fly    67 TVKIIGEEGGSDLNVCDDWLVNELDEEFLQHSCPAEWKDVKPEDFVIW-VDPLDGTAEYTQGHVE 130
            ..|.||||..|....     |.:|.:|      |.            | :||:|||..:... ..
  Fly    66 EHKFIGEEESSGAEG-----VKKLTDE------PT------------WIIDPVDGTMNFVHA-FP 106

  Fly   131 HVTVLIGIAVKDAAVGGIIHQPFYQQ------PDGEM--GRTIW--GLKGLGTGGFTAVPAPAGQ 185
            |..:.:|:.|......|:::.|..:|      ..|..  ||.|.  |.|.||....|:      :
  Fly   107 HSCISVGLKVNKVTELGLVYNPILEQRFTARRGHGAFYNGRRIHVSGQKELGKALVTS------E 165

  Fly   186 FIITTTRSHSNALHQQALNAFASTEVLKV-GGAGFKVLQLLEGKAHA-YVFATPGCKKWDTCAPE 248
            |..|...:....:|:...........|:| |.|...:..:..|.|.| |.|   |...||.||.:
  Fly   166 FGTTRDEAKMKVVHENFEKMAKKAHGLRVLGSAALNMSMVALGAADANYEF---GIHAWDVCAGD 227

  Fly   249 AVLEAQGGCLTNINGEHYAYNADVEHVNRQGVLASLGQDHAALVEKI 295
            .::...||.:.:..|..:       .:..:.|||:...:.|..:.|:
  Fly   228 LIVREAGGVVIDPAGGEF-------DIMSRRVLAAATPELAQEISKV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7789NP_651728.1 IPPase 12..294 CDD:238818 68/301 (23%)
CG9391NP_649294.1 IMPase 10..255 CDD:238817 67/293 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445192
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.