DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7789 and CG17028

DIOPT Version :9

Sequence 1:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster


Alignment Length:238 Identity:50/238 - (21%)
Similarity:83/238 - (34%) Gaps:50/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DPQTEADRSAQRCIIASLAKKFPTVKIIGEEGGSDLNVCDDWLVNELDEEFLQHSCPAEWKDVKP 108
            |..|..|:..:..:...|.|.||..||||||..::...                  |.|..|.. 
  Fly    47 DLVTVYDKQIEATLTDGLLKTFPESKIIGEEAMANAKT------------------PPELTDAP- 92

  Fly   109 EDFVIW-VDPLDGTAEYTQGHVEHVTVLIGIAVKDAAVGGIIHQP----FYQQPDGEMGRTIWGL 168
                .| :||:|||..|.: .:.|..:.:|:|:....|.||::.|    .|         :.|..
  Fly    93 ----TWIIDPIDGTNNYVR-KIPHCCISVGLAINKELVLGIVYNPSANELY---------SAWQG 143

  Fly   169 KGLGTGGFTAVPAPAGQF----------IITTTRSHSNALHQQALNAFASTEVLKVGGAGFKVLQ 223
            .|....|.....:.|.:.          :|..::.....:.:....|.::|.....|.|...:..
  Fly   144 HGAYLNGQPIEVSNAKKINQALVCYEISLIVVSKGRDKNVKRLYKLASSATGTRSFGCAALTLCY 208

  Fly   224 LLEGKAHAYVFATPGCKKWDTCAPEAVLEAQGGCLTNINGEHY 266
            :..|:..||  .....|.||......:|...||.:.:.:|..:
  Fly   209 IAAGRCDAY--HVENLKPWDLAGGAVILREAGGRVYHTSGARF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7789NP_651728.1 IPPase 12..294 CDD:238818 50/238 (21%)
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 50/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.