DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7789 and IMPA2

DIOPT Version :9

Sequence 1:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_055029.1 Gene:IMPA2 / 3613 HGNCID:6051 Length:288 Species:Homo sapiens


Alignment Length:271 Identity:68/271 - (25%)
Similarity:99/271 - (36%) Gaps:62/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SSISTAKRAGGIIRDVLKKGDLGIVDKGKNDPQTEADRSAQRCIIASLAKKFPTVKIIGEEGGSD 78
            :::..|.|||.|||..|.:...........|..||.|...:..||:.|.::||:.:.|.||..:.
Human    22 AAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAAS 86

  Fly    79 LNVCDDWLVNELDEEFLQHSCPAEWKDVKPEDFVIW-VDPLDGTAEYTQGHVEHVTVLIGIAVKD 142
            ...|           .|.|| |.            | :||:|||..:.. ....|.|.||.||:.
Human    87 GAKC-----------VLTHS-PT------------WIIDPIDGTCNFVH-RFPTVAVSIGFAVRQ 126

  Fly   143 AAVGGIIH----QPFYQQPDGEMGRTIW--GLKGLGTGGFTAV--------------PAPAGQFI 187
            ....|:|:    :..|   .|..||..:  |.: |...|.|.:              ||....|:
Human   127 ELEFGVIYHCTEERLY---TGRRGRGAFCNGQR-LRVSGETDLSKALVLTEIGPKRDPATLKLFL 187

  Fly   188 ITTTRSHSNALHQQALNAFASTEVLKVGGAGFKVLQLLEGKAHAYVFATPGCKKWDTCAPEAVLE 252
            ....|    .||.:|..      |..:|.:...:..|..|.|.||......|  ||..|...::.
Human   188 SNMER----LLHAKAHG------VRVIGSSTLALCHLASGAADAYYQFGLHC--WDLAAATVIIR 240

  Fly   253 AQGGCLTNING 263
            ..||.:.:.:|
Human   241 EAGGIVIDTSG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7789NP_651728.1 IPPase 12..294 CDD:238818 68/271 (25%)
IMPA2NP_055029.1 IMPase 19..265 CDD:238817 68/271 (25%)
Substrate binding 103..106 1/2 (50%)
Substrate binding 205..207 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.