DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7789 and IMPA1

DIOPT Version :9

Sequence 1:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001138350.1 Gene:IMPA1 / 3612 HGNCID:6050 Length:336 Species:Homo sapiens


Alignment Length:312 Identity:65/312 - (20%)
Similarity:120/312 - (38%) Gaps:76/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MASSISTAKRAGGIIRDVLKKGDLGIVDKGKN-DPQTEADRSAQRCIIASLAKKFPTVKIIGEEG 75
            |..:::.|::||.::.:.: |.::.::.|... |..|..|:..::.:|:|:.:|:|:...|||| 
Human    68 MDYAVTLARQAGEVVCEAI-KNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEE- 130

  Fly    76 GSDLNVCDDWLVNELDEEFLQHSCPAEWKDVKPEDFVIWVDPLDGTAEYTQGHVEHVTVLIGIAV 140
                                  |..|..|.:..::....:||:|||..:.. ....|.|.||.||
Human   131 ----------------------SVAAGEKSILTDNPTWIIDPIDGTTNFVH-RFPFVAVSIGFAV 172

  Fly   141 KDAAVGGIIHQPFYQQPDGEM--GRTIWGLKGLGTGGFTAVPAPAGQFI-----------ITTTR 192
            ......|::    |...:|:|  .|.       |.|.|.     .||.:           :..|.
Human   173 NKKIEFGVV----YSCVEGKMYTARK-------GKGAFC-----NGQKLQVSQQEDITKSLLVTE 221

  Fly   193 SHSNALHQQALNAFASTEVL---------KVGGAGFKVLQLLEGKAHAYVFATPGCKKWDTCAPE 248
            ..|:...:......::.|.|         .||.|...:..:..|.|.||.  ..|...||.....
Human   222 LGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYY--EMGIHCWDVAGAG 284

  Fly   249 AVLEAQGGCLTNINGEHYAYNADVEHVNRQGVLASLGQDHAALVEKIPAEVR 300
            .::...||.|.::.|..:      :.::|:.:.|    ::..|.|:|..|::
Human   285 IIVTEAGGVLMDVTGGPF------DLMSRRVIAA----NNRILAERIAKEIQ 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7789NP_651728.1 IPPase 12..294 CDD:238818 62/304 (20%)
IMPA1NP_001138350.1 IMPase 67..313 CDD:238817 61/297 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.