DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7789 and CG15743

DIOPT Version :9

Sequence 1:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster


Alignment Length:310 Identity:102/310 - (32%)
Similarity:155/310 - (50%) Gaps:24/310 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IMRVMASSISTAKRAGGIIRDV-----LKKGDLGIVDKGKNDPQTEADRSAQRCIIASLAKKFPT 67
            :.:::.::|..|:|.|..:.||     ||:...|..|:|.|||.|:||..:...:...|.:.||.
  Fly    57 LRKMLIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFPR 121

  Fly    68 VKIIGEEGGSDLNVCDDWLVNELDEEFLQHSCPAEWKDVKPEDFVIWVDPLDGTAEYTQGHVEHV 132
            |:|..||   |...|......:||...|..:.......|..:|..:||||||.|.|:|:...|:|
  Fly   122 VQIFSEE---DKEHCKQAHGYDLDPTVLHETAQIPDVTVNAQDVTVWVDPLDATKEFTEELYEYV 183

  Fly   133 TVLIGIAVKDAAVGGIIHQPFYQQPDGEMGRTIWGLKGLGTGGFTA----VPAPAGQF-IITTTR 192
            |.::.:||....:.|:||.||       .|:|.|...|.....:.:    ..:|..|. |||.:|
  Fly   184 TTMVCVAVAGRPIIGVIHSPF-------NGQTAWAWVGNSMSEYLSNLHPQHSPNNQAPIITVSR 241

  Fly   193 SHSNALHQQALNAFA-STEVLKVGGAGFKVLQLLEGKAHAYVFATPGCKKWDTCAPEAVLEAQGG 256
            ||:......|...|. :..:|...|||:||||::...|.||:. |...||||.||.:|:|.|.||
  Fly   242 SHTAGAKDLARGIFGENVSLLTAAGAGYKVLQVVANNATAYLH-TSKIKKWDICAGDAILHALGG 305

  Fly   257 CLTNINGEHYAYNADVEHVNRQGVLASLGQDHAALVEKIPAEVRAAVGAK 306
            .:|.:|.:...|..:...||.:|:||:|.| |...::|: ::.|.|...|
  Fly   306 TMTTLNDQLINYGPEESPVNTEGLLATLEQ-HDEYMDKL-SKYREAHNGK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7789NP_651728.1 IPPase 12..294 CDD:238818 98/292 (34%)
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 98/294 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445194
Domainoid 1 1.000 72 1.000 Domainoid score I499
eggNOG 1 0.900 - - E1_COG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I383
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51321
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43028
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.