DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7789 and Inpp1

DIOPT Version :9

Sequence 1:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001012131.1 Gene:Inpp1 / 316376 RGDID:1306071 Length:396 Species:Rattus norvegicus


Alignment Length:379 Identity:96/379 - (25%)
Similarity:141/379 - (37%) Gaps:132/379 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IMRV--MASSISTAKRAGGIIRDVL---KKGDLGIVDKGKN---DPQTEADRSAQRCIIASLAKK 64
            ::||  .|::|:.|.|....:..:|   |||    .:|.|.   |.:|.||...|..|..::..|
  Rat     8 LLRVSEKAANIARACRQQEALFQLLIEEKKG----AEKNKKFAADFKTLADVLVQEVIKQNMENK 68

  Fly    65 FPTV--KIIGEEGGSDLNVCDDWLVNELDE----------------------------------- 92
            ||.:  |:.|||.....|...:.:..||..                                   
  Rat    69 FPGLGKKVFGEESNEFTNDLGEKITVELQSTEKETAELLSRVLNGNMLASEALAKVVHEDVDLTD 133

  Fly    93 ---EFLQHSCPAEWKDVKPEDFVIWVDPLDGTAEYTQGH-------------VEHVTVLIGIAVK 141
               |.|:.|.|       .|...|||||:|.|.:|.:|.             ::.||:|||  |.
  Rat   134 PTLESLEISIP-------QEILGIWVDPIDSTYQYIKGSANVKSNQGVFPSGLQCVTILIG--VY 189

  Fly   142 DAAVG----GIIHQPFYQQPDGEM---GRTIWGLKGLG--------------------------T 173
            |...|    |:|:|||..|....:   |:..|||..:|                          :
  Rat   190 DLQTGLPLMGVINQPFASQNLTTLRWTGQCYWGLSYMGNNIHSLQLAISKSNSETQTENSDRESS 254

  Fly   174 GGFTAVPAPAGQFIITTTRSHSNALHQQALNAFASTEVLKVGGAGFKVLQLLEGKAHAYVFATPG 238
            ..|:||.:.:.:..|.|           ||:......|....|||:|.|.:::|.|..|:|:...
  Rat   255 NPFSAVISTSEKDTIKT-----------ALSDVCGGSVFPAAGAGYKSLCVVQGLADIYIFSEDT 308

  Fly   239 CKKWDTCAPEAVLEAQGG-------CL-----TNINGEHYAYNADVEHVNRQGV 280
            ..|||:||..|:|.|.||       ||     |.::.....|:  ||:....||
  Rat   309 TYKWDSCAAHAILRAMGGGIVDMKECLERSPDTGLDLPQLLYH--VENKGASGV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7789NP_651728.1 IPPase 12..294 CDD:238818 94/373 (25%)
Inpp1NP_001012131.1 IPPase 4..384 CDD:238818 96/379 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.