DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7789 and Impa2

DIOPT Version :9

Sequence 1:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_757378.1 Gene:Impa2 / 282636 RGDID:628692 Length:290 Species:Rattus norvegicus


Alignment Length:274 Identity:66/274 - (24%)
Similarity:94/274 - (34%) Gaps:70/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SISTAKRAGGIIRDVLKKGDLGIVDKGKNDPQTEADRSAQRCIIASLAKKFPTVKIIGEEGGSDL 79
            ::..|.|||.|||..|.:...........|..||.|...:..|::.|.|:||:.:.|.||..:..
  Rat    25 AVQLALRAGQIIRKALTEEKHVSTKTSAADLVTETDHRVEDLIVSELRKRFPSHRFIAEEATASG 89

  Fly    80 NVCDDWLVNELDEEFLQHSCPAEWKDVKPEDFVIW-VDPLDGTAEYTQGHVEHVTVLIGIAVKDA 143
            ..|           .|.|| |.            | :||:|||..:.. ....|.|.||.||...
  Rat    90 AKC-----------VLTHS-PT------------WIIDPIDGTCNFVH-RFPTVAVSIGFAVHQE 129

  Fly   144 AVGGIIH----QPFYQQPDGEMGRTIWGLKGLGTGGFTAVPAPAGQFI-ITTTRSHSNALHQQAL 203
            ...|:||    :..|      .||.       |.|.|.     .||.: ::.....:.||....:
  Rat   130 LEFGVIHHCTEERLY------TGRR-------GQGAFC-----NGQRLQVSRETDLAKALVLTEI 176

  Fly   204 NAFASTEVLKV-------------------GGAGFKVLQLLEGKAHAYVFATPGCKKWDTCAPEA 249
            ......:.|||                   |.:...:..|..|.|.||......|  ||..|...
  Rat   177 GPKRDPDTLKVFLSNMERLLHAKAHGVRVIGSSTLALCYLASGAADAYYQFGLHC--WDLAAATV 239

  Fly   250 VLEAQGGCLTNING 263
            ::...||.:.:.:|
  Rat   240 IIREAGGIVIDTSG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7789NP_651728.1 IPPase 12..294 CDD:238818 66/274 (24%)
Impa2NP_757378.1 IMPase 21..266 CDD:238817 66/274 (24%)
Substrate binding. /evidence=ECO:0000250 105..108 1/2 (50%)
Substrate binding. /evidence=ECO:0000250 207..209 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.