DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7789 and Inpp1

DIOPT Version :9

Sequence 1:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_032410.2 Gene:Inpp1 / 16329 MGIID:104848 Length:396 Species:Mus musculus


Alignment Length:358 Identity:97/358 - (27%)
Similarity:140/358 - (39%) Gaps:102/358 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ASSISTAKRAGGIIRDVL---KKGDLGIVDKGKN---DPQTEADRSAQRCIIASLAKKFPTV--K 69
            |::|:.|.|....:..:|   |||    .:|.|.   |.:|.||...|..|..::..|||.:  |
Mouse    15 AANIARACRQQETLFQLLIEEKKG----AEKNKKFAADFKTLADVLVQEVIKQNMENKFPGLGKK 75

  Fly    70 IIGEEGGSDLNVCDDWLVNEL---DEE-------FLQHSCPA-------------------EWKD 105
            :.|||.....|...:.:..||   :||       .|..:.||                   |..|
Mouse    76 VFGEESNEFTNDLGEKITVELQSTEEETAELLSKVLNGNMPASEALAQVVHEDVDLTDPTLESLD 140

  Fly   106 VK--PEDFVIWVDPLDGTAEYTQGH-------------VEHVTVLIGIAVKDAAVG----GIIHQ 151
            :.  .|...|||||:|.|.:|.:|.             ::.||:|||  |.|...|    |:|:|
Mouse   141 ISIPHESLGIWVDPIDSTYQYIKGSANVKSNQGIFPSGLQCVTILIG--VYDLQTGLPLMGVINQ 203

  Fly   152 PFYQQPDGEM---GRTIWGLKGLGT-------------------GGFTAVPAPAGQFIITTTRSH 194
            ||..|....:   |:..|||..:||                   .......:|....|.|:.:..
Mouse   204 PFASQNLTTLRWKGQCYWGLSYMGTNIHSLQLAISKSDSETQTENSDREFSSPFSAVISTSEKDT 268

  Fly   195 SNALHQQALNAFASTEVLKVGGAGFKVLQLLEGKAHAYVFATPGCKKWDTCAPEAVLEAQGG--- 256
            ..|    ||:......|....|||:|.|.:::|.|..|:|:.....|||:||..|:|.|.||   
Mouse   269 IKA----ALSRVCGGSVFPAAGAGYKSLCVIQGLADIYIFSEDTTYKWDSCAAHAILRAMGGGIV 329

  Fly   257 ----CL-----TNINGEHYAYNADVEHVNRQGV 280
                ||     |.::.....|:  ||:....||
Mouse   330 DMKECLERSPDTGLDLPQLLYH--VENKGASGV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7789NP_651728.1 IPPase 12..294 CDD:238818 97/358 (27%)
Inpp1NP_032410.2 IPPase 4..384 CDD:238818 97/358 (27%)
Substrate binding. /evidence=ECO:0000250 155..158 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.