DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7834 and etfb

DIOPT Version :9

Sequence 1:NP_651727.1 Gene:CG7834 / 43515 FlyBaseID:FBgn0039697 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_989154.1 Gene:etfb / 394759 XenbaseID:XB-GENE-956098 Length:254 Species:Xenopus tropicalis


Alignment Length:251 Identity:175/251 - (69%)
Similarity:199/251 - (79%) Gaps:0/251 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAVSVGPA 67
            |.|||||||||||||||||||||||||.|||||||||.||||||||:|||||:..|:||||.||.
 Frog     4 RALVGVKRVIDYAVKVRVKPDKTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKIVSEIIAVSCGPQ 68

  Fly    68 QSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGKQAIDDDANQT 132
            |.||.||||||||||||:|||:.|.:.|.|.|..||||:|.||..|..:||::||||||||.|||
 Frog    69 QCQETIRTALAMGADRGIHVEVAAKDAESLGPFQVSKIMAALAKKENVNLVLMGKQAIDDDCNQT 133

  Fly   133 AQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSADLRLNTPRYATLPNIM 197
            .|||||:||||||||.::::.....||:.||:|||||||..|.|||::||||||.||||||||||
 Frog   134 GQMTAALLDWPQGTFASEVKVEGEKLTVVREVDGGLETISVKLPAVVTADLRLNEPRYATLPNIM 198

  Fly   198 KAKKKPLKKVTAKDLGVDTSPRIEVISVEDPPVRQAGATVADVDALVAKLKEGGHI 253
            |||||.::.|...|||||.:.||.|:||||||.|.||..|..|..||:||||.|.|
 Frog   199 KAKKKKIETVKPSDLGVDITSRIRVLSVEDPPQRLAGVKVETVQDLVSKLKESGRI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7834NP_651727.1 FixA 3..249 CDD:224997 171/245 (70%)
etfbNP_989154.1 FixA 3..254 CDD:224997 174/249 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 252 1.000 Domainoid score I2045
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1503
Inparanoid 1 1.050 341 1.000 Inparanoid score I2300
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1092876at2759
OrthoFinder 1 1.000 - - FOG0003778
OrthoInspector 1 1.000 - - oto103928
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R419
SonicParanoid 1 1.000 - - X3716
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.