DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and PEA15

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001284505.1 Gene:PEA15 / 8682 HGNCID:8822 Length:151 Species:Homo sapiens


Alignment Length:52 Identity:19/52 - (36%)
Similarity:26/52 - (50%) Gaps:9/52 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 EH-FEVPTLKSRAGTNVDCENLTRVLK-----QLDFEVT-VYKDCRYKDILR 146
            || ||:..........||..  |||||     :||.::| :....:||||:|
Human    85 EHIFEISRRPDLLTMVVDYR--TRVLKISEEDELDTKLTRIPSAKKYKDIIR 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 19/52 (37%)
PEA15NP_001284505.1 DED_PEA15 23..106 CDD:260045 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.