DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and CASP5

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001129584.1 Gene:CASP5 / 838 HGNCID:1506 Length:447 Species:Homo sapiens


Alignment Length:290 Identity:77/290 - (26%)
Similarity:123/290 - (42%) Gaps:48/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PSSSYRKNVAK---------MVTDRHAAEY--NMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDC 119
            |.|:...|:.|         :....|...|  ..|...|.:|||..:..|:  .|.:|.|.:.|.
Human   167 PESAESTNILKLCPREEFLRLCKKNHDEIYPIKKREDRRRLALIICNTKFD--HLPARNGAHYDI 229

  Fly   120 ENLTRVLKQLDFEVTVYKDCRYKD---ILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQ 181
            ..:.|:|:.|.:.|...|:...:|   :||.  :||...|..||...:.::|||.:..|..  |.
Human   230 VGMKRLLQGLGYTVVDEKNLTARDMESVLRA--FAARPEHKSSDSTFLVLMSHGILEGICG--TA 290

  Fly   182 YK--------LDNIWSFFTANHCPSLAGKPKLFFIQACQGDR--------LDGGVTMQRSQTETD 230
            :|        .|.|:..|...:|.||..|||:..:|||:|::        ....:.:..||:..:
Human   291 HKKKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQSSEN 355

  Fly   231 GDSSMSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRV 295
            .::....||....||:...|:.|...|||:.||||.|:    .||....::......|..:.::|
Human   356 LEADSVCKIHEEKDFIAFCSSTPHNVSWRDRTRGSIFI----TELITCFQKYSCCCHLMEIFRKV 416

  Fly   296 AVDFESCTPDTPEMHQQKQIPCI-TTMLTR 324
            ...||     .|:  .:.|:|.| ...|||
Human   417 QKSFE-----VPQ--AKAQMPTIERATLTR 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 72/261 (28%)
CASP5NP_001129584.1 DD 76..155 CDD:301326
CASc 196..445 CDD:214521 72/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.