DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and CASP4

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001216.1 Gene:CASP4 / 837 HGNCID:1505 Length:377 Species:Homo sapiens


Alignment Length:276 Identity:70/276 - (25%)
Similarity:118/276 - (42%) Gaps:49/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KMVTDRHAAEYNMRHKNR--GMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKD 138
            ::..:|....|.::.:|.  .:|||..:..|:  .|..|.|.:.|...:..:|:.||:.|.|.::
Human   116 RLCKERAEEIYPIKERNNRTRLALIICNTEFD--HLPPRNGADFDITGMKELLEGLDYSVDVEEN 178

  Fly   139 CRYKDILRTIE-YAASQNHSDSDCILVAILSHGEM----GYIY--AKDTQYKLDNIWSFFTANHC 196
            ...:|:...:. :|....|..||...:.::|||.:    |.::  .|......|.|:..|...:|
Human   179 LTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNC 243

  Fly   197 PSLAGKPKLFFIQACQGDR------LDGGVTMQ--RSQTETDGDSSMSYKIPVHADFLIAYSTVP 253
            .||..|||:..:|||:|..      .|...:::  .||:..:.:....||..|..||:...|:.|
Human   244 LSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDFIAFCSSTP 308

  Fly   254 GFYSWRNTTRGSWFMQSL---------CAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEM 309
            ...|||::|.||.|:..|         |..|..             |.::|...||     ||  
Human   309 HNVSWRDSTMGSIFITQLITCFQKYSWCCHLEE-------------VFRKVQQSFE-----TP-- 353

  Fly   310 HQQKQIPCITTM-LTR 324
            ..:.|:|.|..: :||
Human   354 RAKAQMPTIERLSMTR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 69/266 (26%)
CASP4NP_001216.1 Required for LPS-binding. /evidence=ECO:0000250|UniProtKB:P70343 1..59
CARD_CASP1-like 5..81 CDD:260036
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104
CASc 126..375 CDD:214521 69/266 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.