DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and Casp6

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001258913.1 Gene:Casp6 / 83584 RGDID:70967 Length:277 Species:Rattus norvegicus


Alignment Length:273 Identity:110/273 - (40%)
Similarity:147/273 - (53%) Gaps:39/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 AAEYNMRHKNRGMALIFNHE----HFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKD 143
            |.:|.|.||.||.|||||||    |..:|   .|.|||.|.:||||...:|.|||..:.|.|.::
  Rat    17 AEQYKMDHKRRGTALIFNHERFFWHLALP---ERRGTNADRDNLTRRFSELGFEVKCFNDLRAEE 78

  Fly   144 ILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFI 208
            :|..|...::.:|.|:||.|...|||||..:|||.|.:.::..:...|..:.|.||.||||:|.|
  Rat    79 LLLKIHEVSTSSHVDADCFLCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCQSLVGKPKIFII 143

  Fly   209 QACQG-----------------DRLDGGVTMQRSQTETDGDSSMSYKIPVHADFLIAYSTVPGFY 256
            |||:|                 |:||..||..        |::..|.:|..||||:.||...|:|
  Rat   144 QACRGSQHDVPVVPLDVVDHQTDKLDDNVTQV--------DAASVYTLPAGADFLMCYSVAEGYY 200

  Fly   257 SWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVA---VDFESCTPDTPEMHQQKQIPCI 318
            |.|.|..|||::|.||..||.:|..|:...|||.|.::|:   |||  |  ..|....:||:||.
  Rat   201 SHRETVNGSWYIQDLCEMLARHGSSLEFTELLTLVNRKVSQRRVDF--C--KDPGAIGKKQVPCF 261

  Fly   319 TTMLTRILRFSDK 331
            .:|||:.|.|..|
  Rat   262 ASMLTKKLHFCPK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 108/267 (40%)
Casp6NP_001258913.1 CASc 20..273 CDD:214521 108/267 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.