DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and XB5812047

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_031753853.1 Gene:XB5812047 / 733553 XenbaseID:XB-GENE-5812048 Length:244 Species:Xenopus tropicalis


Alignment Length:252 Identity:82/252 - (32%)
Similarity:131/252 - (51%) Gaps:28/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 MRHKNRGMALI-----FNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRT 147
            |..:.:|.|:|     |:..|.||.:|..|.|...|...|.:||.:|.::|:::.|...|:|...
 Frog     2 MLKEMKGRAVIIAISEFHPRHGEVGSLDQRKGVKRDVNRLFKVLSRLGYKVSLHMDVSAKEIKDI 66

  Fly   148 IEYAASQNHSDSDCILVAIL-SHGEMGYIY-AKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQA 210
            .:..:.....:|   .::|| |||..|.|| ...|...|.:::.....|:.|.|||.|||||:||
 Frog    67 YQKESKMPQGES---FISILSSHGNEGLIYDFYGTPVLLRDLYDILAPNNSPLLAGVPKLFFVQA 128

  Fly   211 CQGDRLDGGVTMQRSQTETDGDS------SMSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQ 269
            |:|::.|.||.:     |||||:      |:|..:|  .|.::.:::..|..:::| ..||.|:|
 Frog   129 CRGEQFDEGVFL-----ETDGDTCATDAFSLSLNLP--RDSVLMFASSEGHVAFQN-PGGSVFLQ 185

  Fly   270 SLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRIL 326
            :||..|....:.|::..:||.:...||..|:|    ..:....|::||.||.|||.|
 Frog   186 TLCNLLEGEERNLELNRILTRLAHMVAYTFQS----QGQYGGFKEMPCYTTNLTREL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 82/252 (33%)
XB5812047XP_031753853.1 CASc 1..239 CDD:412128 82/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.