DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and Casp8

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_071613.1 Gene:Casp8 / 64044 RGDID:620945 Length:482 Species:Rattus norvegicus


Alignment Length:248 Identity:95/248 - (38%)
Similarity:135/248 - (54%) Gaps:25/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 YNMRHKNRGMALIFNHEHF-----EVPTL---KSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYK 142
            |.|:.|.||..||||:.:|     ::|.|   :.|.|||.|.|.|::..|:|.||:..:.||...
  Rat   228 YQMKSKPRGYCLIFNNNNFSKAREDIPKLSNMRDRKGTNYDEEALSKTFKELHFEIVSFSDCTAS 292

  Fly   143 DILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKD-TQYKLDNIWSFFTANHCPSLAGKPKLF 206
            .|...:....|::|...||.:..|||||:.|.:|..| .:..:..:.|:||.:.|||||||||:|
  Rat   293 QIHEVLVSYQSKDHKGKDCFICCILSHGDKGIVYGTDGKEASIYELTSYFTGSKCPSLAGKPKIF 357

  Fly   207 FIQACQGDRLDGGVTM-------QRSQTETDGDSSMSYKIPVHADFLIAYSTVPGFYSWRNTTRG 264
            |||||||:.....|.:       |....|.|..|..:| ||..||||:..:||....|:|:.|||
  Rat   358 FIQACQGNNFQKAVPVPDETGLEQEHVLEEDSSSYKNY-IPDEADFLLGMATVKNCVSYRDPTRG 421

  Fly   265 SWFMQSLCAELAANGKR-LDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIP 316
            :|::||||..|.....| .|||::||      .|:::....|.|. :..||:|
  Rat   422 TWYIQSLCQSLRERCPRGEDILSILT------GVNYDVSNKDNPR-NMGKQMP 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 95/248 (38%)
Casp8NP_071613.1 DED_Caspase_8_r1 3..84 CDD:260041
DD 98..179 CDD:417479
CASc 227..480 CDD:237997 95/248 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.