DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and casp8

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_005165894.1 Gene:casp8 / 58022 ZFINID:ZDB-GENE-000713-1 Length:477 Species:Danio rerio


Alignment Length:229 Identity:79/229 - (34%)
Similarity:117/229 - (51%) Gaps:24/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 YNMRHKNRGMALIFNHEHFEVPT-LKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIE 149
            |.:..:..|..||.|:.:|...| |..|.||::|.:.|.::..::.|::.|..|.....|...|:
Zfish   231 YILTQRPLGYCLIINNYNFLKSTNLLKRTGTDMDKDRLAKLFSRMHFQIEVRSDLEAWAIKDEIK 295

  Fly   150 YAASQNHSDSDCILVAILSHGEMGYIYAKDTQ-YKLDNIWSFFTANHCPSLAGKPKLFFIQACQG 213
            ..|::||:.....:..||||||.|.:...|.: .::..:...|..  |.:||.||||||||||||
Zfish   296 QFANKNHASMGAFVCCILSHGEKGTVLGTDGKPVEIREVTLPFAG--CRTLASKPKLFFIQACQG 358

  Fly   214 DRLDGGV---------TMQRSQTETDGDSSMSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQ 269
            |....||         ..:..:.|.|....:..|||:.|||||..:||..:.|:|:|..||.|:|
Zfish   359 DENQAGVWTSDGREDAPEEDEKYEEDAGIIVLRKIPIEADFLIGMATVEHYLSYRHTKEGSIFIQ 423

  Fly   270 SLC---AELAANGKRLDILTLLTFVCQRVAVDFE 300
            .||   .||..  |:.|:|::||      .|:||
Zfish   424 ELCKKMEELCP--KKEDMLSILT------KVNFE 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 79/229 (34%)
casp8XP_005165894.1 DED_Caspase_8_10_r1 2..76 CDD:260059
DED_Caspase_8_10_r2 96..176 CDD:260042
CASc 230..475 CDD:237997 79/229 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.