DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and casp6a

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001018333.1 Gene:casp6a / 552927 ZFINID:ZDB-GENE-030825-4 Length:298 Species:Danio rerio


Alignment Length:286 Identity:112/286 - (39%)
Similarity:165/286 - (57%) Gaps:10/286 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SGAIGQLANGYSSPSSSYRKNVAKMVTDRHAAEYNMRHKNRGMALIFNHEHFEVPT-LKSRAGTN 116
            |.:.||......:.:.|:.:::..|..::   ||:|.||.||||||||||:|.... |..|:|||
Zfish    17 SASAGQTVEENLTETDSFNQSIFSMDPNQ---EYDMNHKRRGMALIFNHENFFWKLGLGYRSGTN 78

  Fly   117 VDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQ 181
            .|.|||.|..::|:|||..:.|.:..::|..|..||:.:|.|:||::...|||||.|::||.|.|
Zfish    79 ADKENLIRRFRELNFEVKAFDDYKRHEVLSKITEAAAADHVDADCLVCVFLSHGENGHVYANDGQ 143

  Fly   182 YKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVT---MQRSQTETD--GDSSMSYKIPV 241
            .::..|...|..:.|.||.||||:|..|||:||:.|..||   :..||...|  .|:.:.|.:|.
Zfish   144 IEIPEITDLFKGDKCRSLVGKPKIFIWQACRGDKHDDPVTPMDVVDSQVTNDMVVDAGVLYTLPA 208

  Fly   242 HADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDT 306
            .|||::.||...|:||.|.|..|||::|.||..|...|..|:...:||.|.::|::.......|.
Zfish   209 GADFIMCYSVAEGYYSHRETVNGSWYIQDLCEILRRYGSELEFAEILTLVNRKVSLRSVLNCKDR 273

  Fly   307 PEMHQQKQIPCITTMLTRILRFSDKQ 332
            ..: .:||:||..:|||:.|.|..|:
Zfish   274 SAV-GKKQVPCFASMLTKKLFFRPKK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 105/249 (42%)
casp6aNP_001018333.1 CASc 47..294 CDD:237997 104/247 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.