DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and casp10

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_031748482.1 Gene:casp10 / 548432 XenbaseID:XB-GENE-480459 Length:536 Species:Xenopus tropicalis


Alignment Length:276 Identity:97/276 - (35%)
Similarity:146/276 - (52%) Gaps:37/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SSYRKNVAKMVTDRHAAE-YNMRHKNRGMALIFNHEHFEVPTLKS--RAGTNVDCENLTRVLKQL 129
            |..|.| ::|....:..| |:|.||:||..||.::..|    :|.  |.|::.|...|:.|...|
 Frog   266 SDLRLN-SEMTPQANKEEFYDMNHKHRGYCLIIDNSVF----MKGNRREGSDKDAGALSDVFSWL 325

  Fly   130 DFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIY-AKDTQYKLDNIWSFFTA 193
            ..||.::::...:.|...::...|::||:.||.:..||:|||.|.:. :.|.:..:..|.|:|||
 Frog   326 GLEVDIFENLMSEQIRDCLKRFKSRDHSERDCFVCCILTHGESGTVMGSDDKEVSIREIMSYFTA 390

  Fly   194 NHCPSLAGKPKLFFIQACQGDRLDGGVTMQRSQTETDG---DSSMSY--KIPVHADFLIAYSTVP 253
            ..|.||..||||||||||||.     .|...|:.|.|.   :.:..|  .:|..||||:..|||.
 Frog   391 ISCTSLVLKPKLFFIQACQGK-----FTHPSSKVEADAIVPEENKKYVVNVPKDADFLLGMSTVD 450

  Fly   254 GFYSWRNTTRGSWFMQSLC---AELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQ--- 312
            |:.::|:|..|||::|:||   .||...|:  |||.:||.|.:.|::          :..||   
 Frog   451 GYAAYRHTREGSWYIQALCKNLVELVPRGE--DILAILTKVNKDVSL----------KEGQQGIL 503

  Fly   313 KQIPCITTMLTRILRF 328
            ||:|..:..|.:.|||
 Frog   504 KQMPQPSYTLLKKLRF 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 92/257 (36%)
casp10XP_031748482.1 DD 1..82 CDD:417479
DED_Caspase_10_r2 116..191 CDD:260074
CASc 283..520 CDD:237997 92/258 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.