DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and Pea15

DIOPT Version :10

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001013249.1 Gene:Pea15 / 364052 RGDID:1306055 Length:130 Species:Rattus norvegicus


Alignment Length:52 Identity:19/52 - (36%)
Similarity:26/52 - (50%) Gaps:9/52 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 EH-FEVPTLKSRAGTNVDCENLTRVLK-----QLDFEVT-VYKDCRYKDILR 146
            || ||:..........||..  |||||     :||.::| :....:||||:|
  Rat    64 EHIFEISRRPDLLTMVVDYR--TRVLKISEEDELDTKLTRIPSAKKYKDIIR 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 19/52 (37%)
Pea15NP_001013249.1 DED_PEA15 2..85 CDD:260045 6/22 (27%)
Microtubule-binding. /evidence=ECO:0000255 98..107 1/8 (13%)
Microtubule-binding. /evidence=ECO:0000255 122..129
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.