DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and Damm

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster


Alignment Length:232 Identity:63/232 - (27%)
Similarity:100/232 - (43%) Gaps:51/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTI-EYAASQNHSDSDC 161
            |.|||.|...:..:|.|::.|...|.:..:.|...|.|..:....|:...: |::|.:...|:..
  Fly    42 ILNHEQFPQDSQLNRKGSSNDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAGF 106

  Fly   162 ILVAILSHGE-MGYIYAKD-TQYKLDN--IWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTM 222
            :|. |||||: ...|.|.| .:|.||:  ::..|   ..|:|:||||:..:|||:|         
  Fly   107 VLF-ILSHGDRKEKILACDHREYHLDDDVLFPLF---RNPTLSGKPKILIVQACKG--------- 158

  Fly   223 QRSQTETDGDSSMSYKIPVHAD--------FLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANG 279
                             |:.||        ::..||...|:.|:||...||.|:|:||..:...|
  Fly   159 -----------------PLRADAKKMNNEPYIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYG 206

  Fly   280 KRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIP 316
            ...|..::...|  :..|:..|      .|...||:|
  Fly   207 LTRDFQSIFKHV--KAEVERRS------TMTGSKQVP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 63/232 (27%)
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.