Sequence 1: | NP_524551.2 | Gene: | Drice / 43514 | FlyBaseID: | FBgn0019972 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036246.1 | Gene: | CASP14 / 23581 | HGNCID: | 1502 | Length: | 242 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 60/197 - (30%) |
---|---|---|---|
Similarity: | 102/197 - (51%) | Gaps: | 19/197 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 110 KSRAGTNVDCENLTRVLKQLDFEVTVYKDC---RYKDILRTIEYAASQNHSDSDCILVAILSHGE 171
Fly 172 MGYIYAKDTQ-YKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTMQRSQTETDGD--- 232
Fly 233 ---SSMSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQR 294
Fly 295 VA 296 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Drice | NP_524551.2 | CASc | 86..330 | CDD:214521 | 60/197 (30%) |
CASP14 | NP_036246.1 | CASc | 18..242 | CDD:237997 | 60/197 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3573 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |