DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and CASP14

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_036246.1 Gene:CASP14 / 23581 HGNCID:1502 Length:242 Species:Homo sapiens


Alignment Length:197 Identity:60/197 - (30%)
Similarity:102/197 - (51%) Gaps:19/197 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 KSRAGTNVDCENLTRVLKQLDFEVTVYKDC---RYKDILRTIEYAASQNHSDSDCILVAILSHGE 171
            |:|.|:..|.:.|..:.:||.||.|:.:|.   ::::.|...:.|.........|..|.:::||.
Human    27 KAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQFQEELEKFQQAIDSREDPVSCAFVVLMAHGR 91

  Fly   172 MGYIYAKDTQ-YKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTMQRSQTETDGD--- 232
            .|::..:|.: .||:|::......:|.:|..|||::.||||:|::.|.|.|:       .||   
Human    92 EGFLKGEDGEMVKLENLFEALNNKNCQALRAKPKVYIIQACRGEQRDPGETV-------GGDEIV 149

  Fly   233 ---SSMSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQR 294
               ......||.:.|.|..||||.|:.::|:..:||.|:|:|......  ::..||.|||.|.:|
Human   150 MVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTK--RKGHILELLTEVTRR 212

  Fly   295 VA 296
            :|
Human   213 MA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 60/197 (30%)
CASP14NP_036246.1 CASc 18..242 CDD:237997 60/197 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.