DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and ZK795.2

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_502403.2 Gene:ZK795.2 / 178206 WormBaseID:WBGene00014082 Length:292 Species:Caenorhabditis elegans


Alignment Length:139 Identity:32/139 - (23%)
Similarity:49/139 - (35%) Gaps:38/139 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GSGAIGQLANGYSSPSSSYRKNVAKMVTDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTN 116
            |||||..:..|..:       :||...|....|.|..:|:.:. ..||.||:..:          
 Worm    25 GSGAIKMVVMGKDT-------DVAWQKTIDGIALYIAKHQVKS-PQIFVHENGSI---------- 71

  Fly   117 VDCE---NLTRVLKQLDFEVTVYKDCRYK------------DILRTIEYAASQNHSDSDCILVA- 165
              ||   .:.|...:.||.:.:.|....|            .:| .||...:.:.:|.|....| 
 Worm    72 --CEFIGGVDRSKMRADFILVIKKHTSQKLKCDPEWGRQSFGVL-NIEKYPTLSQTDEDLAFTAK 133

  Fly   166 -ILSHGEMG 173
             |.:..|.|
 Worm   134 IIFNSSETG 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 22/105 (21%)
ZK795.2NP_502403.2 DUF1510 180..>263 CDD:284770
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.