DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and csp-1

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001022452.1 Gene:csp-1 / 175007 WormBaseID:WBGene00000819 Length:536 Species:Caenorhabditis elegans


Alignment Length:290 Identity:83/290 - (28%)
Similarity:140/290 - (48%) Gaps:42/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YSSPSSSYRKNVAKMVTDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLK 127
            |.|.|...|.: ||....:|...|.|....||..||.::|:|:  .::.|.||..|..|||::.:
 Worm   263 YDSQSRMPRTD-AKKSNHKHKYCYEMNSNPRGTVLILSNENFK--NMERRVGTKQDEVNLTKLFQ 324

  Fly   128 QLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGE-MGYIYAKDTQYKLDNIW--S 189
            :|.:.|...::...:.:|..|:..|...|:||  |::.:||||: .|.::..|....  |:.  |
 Worm   325 KLQYTVICKRNLEAESMLEAIKEFAEMAHTDS--IILFLLSHGDGAGSVFGIDDMPV--NVMEVS 385

  Fly   190 FFTANHCPSLAGKPKLFFIQACQGDRLDGGVTMQRSQTETDG---------------DSSMSYKI 239
            .:.|.| .:|..|||...:.||:|.:|:.||.:       ||               :..||..:
 Worm   386 TYLAYH-QNLLLKPKWVAVSACRGGKLNMGVPV-------DGLPALEDKCAPISKFWNLMMSRIM 442

  Fly   240 P-----VHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDF 299
            |     ::||.:|::||..||.|:|:...|:|:::|:|.....:.|.:.:|.:||...:.|...:
 Worm   443 PGTFTSLNADVIISFSTTDGFTSYRDEEAGTWYIKSMCKVFNKHSKTMHLLDILTETGRNVVTKY 507

  Fly   300 ESCTPDTPEMHQQKQIPCITTMLTRILRFS 329
            |:...:.    ..||.|.|.:.||:...||
 Worm   508 ENVQGNV----VLKQAPEILSRLTKQWHFS 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 76/267 (28%)
csp-1NP_001022452.1 SPK 76..188 CDD:214732
CASc 285..533 CDD:214521 74/265 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I3239
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5027
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 1 1.000 - - mtm4766
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.