DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and Casp12

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_569106.1 Gene:Casp12 / 156117 RGDID:621758 Length:420 Species:Rattus norvegicus


Alignment Length:215 Identity:58/215 - (26%)
Similarity:98/215 - (45%) Gaps:23/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 MVTDRHAAEYNMRHK--NRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDC 139
            |.|:|....|.:..|  ...:|||..::.|:.  |..|.....|..|:..:|:.|.:.|.:.::.
  Rat   158 MKTERAEEIYPVMEKEGRTRLALIICNKKFDY--LFDRDDAETDILNMKELLQNLGYSVVIKENL 220

  Fly   140 RYKDI-LRTIEYAASQNHSDSDCILVAILSHGEM-GYIYAKDTQYKL-----DNIWSFFTANHCP 197
            ..::: ...:::|....|..||...:..:|||.: |....|....|.     |.|::.|..::||
  Rat   221 TAQEMETELMKFAGRPEHQSSDSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFTIFNNSNCP 285

  Fly   198 SLAGKPKLFFIQACQGDRLDGGVTMQRSQ----TETDGDSSMSY-------KIPVHADFLIAYST 251
            ||..|||:..:|||:| |..|.:.:..|:    .:||.:..:|:       |..|..||:...|:
  Rat   286 SLRNKPKILIMQACRG-RHTGTIWVSTSKGIATADTDEECVLSHRWNNSITKAHVETDFIAFKSS 349

  Fly   252 VPGFYSWRNTTRGSWFMQSL 271
            .|...||:....||.|:..|
  Rat   350 TPHNISWKVGKSGSLFISKL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 55/206 (27%)
Casp12NP_569106.1 CARD_CASP1-like 6..88 CDD:260036
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..115
CASc 167..418 CDD:214521 55/206 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.