| Sequence 1: | NP_524551.2 | Gene: | Drice / 43514 | FlyBaseID: | FBgn0019972 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_033941.3 | Gene: | Casp6 / 12368 | MGIID: | 1312921 | Length: | 276 | Species: | Mus musculus |
| Alignment Length: | 49 | Identity: | 12/49 - (24%) |
|---|---|---|---|
| Similarity: | 19/49 - (38%) | Gaps: | 13/49 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 928 PGTYIRVAEETRSWENGKWLIFDDSFEHEVWHNGTETRLVLIVDFWHPE 976 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Drice | NP_524551.2 | CASc | 86..330 | CDD:214521 | |
| Casp6 | NP_033941.3 | CASc | 20..272 | CDD:214521 | 12/49 (24%) |
| Tri-arginine exosite. /evidence=ECO:0000250|UniProtKB:P55212 | 25..27 | ||||
| 130's region. /evidence=ECO:0000250|UniProtKB:P55212 | 108..125 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||