DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and Casp6

DIOPT Version :10

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_033941.3 Gene:Casp6 / 12368 MGIID:1312921 Length:276 Species:Mus musculus


Alignment Length:49 Identity:12/49 - (24%)
Similarity:19/49 - (38%) Gaps:13/49 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   928 PGTYIRVAEETRSWENGKWLIFDDSFEHEVWHNGTETRLVLIVDFWHPE 976
            ||.|...|::...|.      ..::.|.|.|.:|:..|       :|.|
Mouse   149 PGYYDIAAQDVSVWH------VPNNMELEHWSHGSILR-------YHTE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521
Casp6NP_033941.3 CASc 20..272 CDD:214521 12/49 (24%)
Tri-arginine exosite. /evidence=ECO:0000250|UniProtKB:P55212 25..27
130's region. /evidence=ECO:0000250|UniProtKB:P55212 108..125
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.