DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and Casp3

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001271338.1 Gene:Casp3 / 12367 MGIID:107739 Length:277 Species:Mus musculus


Alignment Length:247 Identity:105/247 - (42%)
Similarity:152/247 - (61%) Gaps:8/247 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 AEYNMRHKNRGMALIFNHEHFEVPT-LKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRT 147
            :.|.|.:...|:.:|.|:::|...| :.||:||:||..||......|.::|....|...:|||..
Mouse    35 SSYKMDYPEMGICIIINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILEL 99

  Fly   148 IEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQ 212
            ::..:.::||.....:..|||||:.|.||..:...:|..:.|||..::|.||.||||||.||||:
Mouse   100 MDSVSKEDHSKRSSFVCVILSHGDEGVIYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQACR 164

  Fly   213 GDRLDGGVTMQRSQTETDGDSSMS-YKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELA 276
            |..||.|:     :|::..|..|: .||||.||||.||||.||:|||||:..||||:||||:.|.
Mouse   165 GTELDCGI-----ETDSGTDEEMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLK 224

  Fly   277 ANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRILRF 328
            ....:|:.:.:||.|.::||.:|||.:.|: ..|.:||||||.:|||:.|.|
Mouse   225 LYAHKLEFMHILTRVNRKVATEFESFSLDS-TFHAKKQIPCIVSMLTKELYF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 105/245 (43%)
Casp3NP_001271338.1 CASc 37..277 CDD:214521 105/245 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836968
Domainoid 1 1.000 202 1.000 Domainoid score I2975
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 208 1.000 Inparanoid score I3679
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 1 1.000 - - mtm8756
orthoMCL 1 0.900 - - OOG6_103710
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3066
SonicParanoid 1 1.000 - - X460
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.690

Return to query results.
Submit another query.