DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and Cflar

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001029036.1 Gene:Cflar / 117279 RGDID:620847 Length:480 Species:Rattus norvegicus


Alignment Length:272 Identity:61/272 - (22%)
Similarity:100/272 - (36%) Gaps:64/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 HPYGSGAIGQLANGYSSP------SSSYRKNVAKMVTDR--------HAAEYNMRHKNRGMALIF 99
            |.|.|    :|.||.|..      ....||.|...:.:.        |...|.|:.|..|:.|| 
  Rat   202 HLYNS----RLQNGRSKEPRFVEHHGIQRKPVKTSIQESGIFLPPHIHEESYRMQSKPLGICLI- 261

  Fly   100 NHEHFEVPTLKSRAGTNVDC-----ENLTRVLKQLDFEVTVYKDCRYKDILRTI-EYAASQNHSD 158
                             :||     |.|......|.:.|..:......:|.:.: .::....|.|
  Rat   262 -----------------IDCIGNDTEYLRETFTSLGYRVQPFLFPSSHEITQIVRRFSNMTQHQD 309

  Fly   159 SDCILVAILSHGEMGYIYAKDTQY---KLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGV 220
            .|..:..::|.|....:...|..|   .|:|:...|..:.||||.|||||||||..:        
  Rat   310 YDSFVCVLVSRGGSQSMMGVDQVYSGFSLENVKDMFKGDMCPSLRGKPKLFFIQNYE-------- 366

  Fly   221 TMQRSQTETDGDS----SMSYKIPVH------ADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAEL 275
            .::.:..|.||.:    :..:..|.|      ||...:..|.......:.::..|.::|.| ::|
  Rat   367 ALEDNSLEVDGPAIKNVNSRHLHPRHCTTHPDADIFWSLCTADVSRLEQPSSSLSVYLQKL-SQL 430

  Fly   276 AANGKRLDILTL 287
            ...|::..::.|
  Rat   431 LEQGRKRSLVDL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 50/221 (23%)
CflarNP_001029036.1 DED_c-FLIP_r1 6..85 CDD:260044
DED_c-FLIP_r2 96..176 CDD:260046
CASc 249..479 CDD:412128 50/221 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.