DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and CARD16

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_011540885.1 Gene:CARD16 / 114769 HGNCID:33701 Length:265 Species:Homo sapiens


Alignment Length:82 Identity:18/82 - (21%)
Similarity:29/82 - (35%) Gaps:25/82 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 CPSLAGKPKLFFIQACQ---GDRLD----GGVTMQRSQTETDGDSSMSY---------------- 237
            |.|..|:.||.|::..|   ..:|.    ....::.|:..|.|...|.:                
Human   173 CSSPEGRIKLCFLEDAQRIWKQKLQRCHVQNTIIKWSERYTSGSFEMQWLFLRTNFIERFWRNIL 237

  Fly   238 KIPVHADFLIAYSTVPG 254
            .:|:|...|  |..:||
Human   238 LLPLHKGSL--YPRIPG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 18/82 (22%)
CARD16XP_011540885.1 CARD_CASP1-like 73..155 CDD:260036
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.