DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and Casp4

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_446188.2 Gene:Casp4 / 114555 RGDID:621757 Length:373 Species:Rattus norvegicus


Alignment Length:255 Identity:73/255 - (28%)
Similarity:117/255 - (45%) Gaps:49/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 ALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTI-EYAASQNHSDS 159
            |||..:..|:  .|..|.|.|:|...:..:|::|.::|.|.::...:.:...: ::||...|..|
  Rat   134 ALIICNTEFK--HLSLRYGANIDISGMKGLLEELGYDVVVKEELTAEGMESEMKDFAALSEHQTS 196

  Fly   160 DCILVAILSHGEM----GYIYAKDTQYKL--DNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDG 218
            |...:.::|||.:    |.::::.|...|  |.|:..|...|||.|..|||:..:|||:|.. .|
  Rat   197 DSTFLVLMSHGTLQGLCGTMHSEATPDVLLYDTIYQIFNNCHCPGLRDKPKVIIVQACRGGN-PG 260

  Fly   219 GVTMQRSQTETDGDSSMSYK---IP------------VHADFLIAYSTVPGFYSWRNTTRGSWFM 268
            .|.::.|      ..:.||:   :|            |..||:..|||.|...|:|:.||||:|:
  Rat   261 EVWIRES------SGAHSYRAVDLPRNMEADAVRMSHVEKDFIALYSTTPHHLSYRDKTRGSYFI 319

  Fly   269 QSL--CAELAANGKRL-DILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCI-TTMLTR 324
            ..|  |..:.|....| ||..       :|...||..:.::       |:|.| ...|||
  Rat   320 SKLISCFRIHACSCHLFDIFL-------KVQQSFEKASINS-------QMPTIDRATLTR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 73/255 (29%)
Casp4NP_446188.2 CARD_CASP1-like 5..85 CDD:260036
CASc 122..371 CDD:214521 73/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.