DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and casp17

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_017213601.1 Gene:casp17 / 101886133 ZFINID:ZDB-GENE-190425-2 Length:276 Species:Danio rerio


Alignment Length:246 Identity:83/246 - (33%)
Similarity:128/246 - (52%) Gaps:24/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 NMRHKNRGMALIFNHEHFEVPT-LKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEY 150
            |.|.|||  |||.:.|:|.... |::|.|...|.:.|.::|.:|.|.|.:..|....:|:...:.
Zfish    12 NKRMKNR--ALIVSVENFYPDALLRNRPGAKKDTQRLHKILMKLGFSVDIRVDMEAGEIIEAFKQ 74

  Fly   151 AASQNHSDSDCILVAILSHGEMGYIYAKDTQ-YKLDNIWSFFTANHCPSLAGKPKLFFIQACQGD 214
            .:.|  :..:|.:..|.||||.|.::..|.: ..|..|:|.|.:   |.:..|.|||.||||:|.
Zfish    75 ESEQ--TVKECFVGIISSHGEEGVVFGCDGRAVNLAEIYSCFRS---PIMKDKSKLFLIQACRGG 134

  Fly   215 RLDGGVTMQRSQTETDGDSS-----MSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAE 274
            .|||||     |.|||..||     :|..:.:..|..:.|:|.||:.::.:.. ||..:|:||..
Zfish   135 DLDGGV-----QVETDSSSSEEQDILSELLSIPIDTAVTYATSPGYAAFMHPL-GSVLIQTLCDL 193

  Fly   275 LAAN-GKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTR 324
            |.:: |..|:|..|||.:..:||.:|::   ....:..:||:||..|..||
Zfish   194 LESDGGPDLEITKLLTRLNHQVAYNFQA---RGKILGGKKQMPCFVTRFTR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 83/246 (34%)
casp17XP_017213601.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.