DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and casp1

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_012813105.2 Gene:casp1 / 100491605 XenbaseID:XB-GENE-485195 Length:408 Species:Xenopus tropicalis


Alignment Length:225 Identity:68/225 - (30%)
Similarity:107/225 - (47%) Gaps:32/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 YNMRHK--NRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTI 148
            |.||.:  .:.:|||..:|.||  ||..|.|..||.:.:|::|.:|.::|....:...:::|:.:
 Frog   158 YEMRKREGRKRLALIICNEKFE--TLTERQGAKVDLDGMTKLLNELGYQVLQETNLAKEEMLKVL 220

  Fly   149 -EYAASQNHSDSDCILVAILSHGEMGYIYAKDTQ--------------YKLDNIWSFFTANHCPS 198
             |:||.:.|.|||...:.::|||:...:...|::              .:.|.|:|.|...|||.
 Frog   221 KEFAAREEHVDSDSTFIVLMSHGDKPGVCGTDSKKIEHEKGQCQVTNLLQTDEIFSIFNNIHCPK 285

  Fly   199 LAGKPKLFFIQACQGDR------LDGGVTMQRSQTETDGDSSMSYKIPVHADFLIAYSTVPGFYS 257
            |..|||:..||||:|:.      .|........|.|.|.    .:::....||:...|:.|...|
 Frog   286 LRDKPKVIIIQACRGEERGQKLVCDAVALPPEEQLEDDA----LHRVQRETDFICFCSSTPDTVS 346

  Fly   258 WRNTTRGSWFMQSLCA---ELAANGKRLDI 284
            ||:.|.||.|:..|..   |||.....:||
 Frog   347 WRHPTMGSLFITGLIKKMNELAHCQPLMDI 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 68/225 (30%)
casp1XP_012813105.2 DD 4..86 CDD:417479
CASc 158..406 CDD:214521 68/225 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.