DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and casp2

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_012809163.2 Gene:casp2 / 100486813 XenbaseID:XB-GENE-482390 Length:421 Species:Xenopus tropicalis


Alignment Length:258 Identity:87/258 - (33%)
Similarity:131/258 - (50%) Gaps:17/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 HAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILR 146
            |...|.|....||.|||.::..||...|..|.|..||..:|.::...|.|:|.|.::...::::.
 Frog   158 HQQAYKMHSCPRGRALIISNVAFETQDLDHRYGGEVDVASLEKLFSSLGFQVEVRRNLNAQNMMS 222

  Fly   147 TI-EYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTA---NHCPSLAGKPKLFF 207
            .: .::|...||..|..:||:||||..|.:|..|.  ||..:...|||   .|||.|..|||:||
 Frog   223 QLGAFSALPAHSALDSCVVAVLSHGLDGAVYGTDG--KLVQLQDVFTAMDNAHCPQLQNKPKMFF 285

  Fly   208 IQACQGDRLDGGVTMQ--RSQT------ETD-GDSSMSYKIPVHADFLIAYSTVPGFYSWRNTTR 263
            ||||:|:..|.||..:  |.|:      ::| |...:..::|..:|.:.||:.:.|..|.|||.|
 Frog   286 IQACRGEEADRGVDQRDGREQSASPGCEQSDAGREDIKVRLPTQSDMICAYACLKGTVSLRNTKR 350

  Fly   264 GSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRIL 326
            ||||:|.|.:..:...|...:..:|..| ..:..:.|...|.| |.|:.|::....:.|.|.|
 Frog   351 GSWFVQDLVSVFSQYSKNTHVADMLVKV-NALIKEREGHAPGT-EFHRCKEMSEYCSTLCRDL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 86/254 (34%)
casp2XP_012809163.2 DD 5..86 CDD:417479
CASc 161..414 CDD:237997 86/255 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.