DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drice and casp20

DIOPT Version :9

Sequence 1:NP_524551.2 Gene:Drice / 43514 FlyBaseID:FBgn0019972 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001129724.1 Gene:casp20 / 100192215 ZFINID:ZDB-GENE-081022-114 Length:347 Species:Danio rerio


Alignment Length:254 Identity:88/254 - (34%)
Similarity:123/254 - (48%) Gaps:42/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RHAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKD---CRYK 142
            :..::|.:....||:.:|.|:..|  .::|.|.|::.|.:.|.:|.:.|.|||..:::   ...|
Zfish   101 QEVSQYKITQNPRGICVIINNVDF--TSMKERRGSDEDQKYLAKVFRWLGFEVVAHRNKTAAEMK 163

  Fly   143 DIL----RTIEYAASQNHSDSDCILVAILSHG-EMGYIYAKDTQYKLDNIWSFFTANHCPSLAGK 202
            :||    ||:         |.||.:..:|||| :.|......:...:|.|...||..:|..|.||
Zfish   164 NILQALGRTV---------DGDCFVCCVLSHGMKEGVCGTDGSLVSVDEIRDPFTGINCQKLVGK 219

  Fly   203 PKLFFIQACQGDRLDGGVTMQ-------RSQTETDGDSSMSYKIPVHADFLIAYSTVPGFYSWRN 260
            |||||||||:|.|....|..|       .|:.|.||| .....||...|||||.||..|..|:|.
Zfish   220 PKLFFIQACRGQRKQLRVNAQADGPGDGESEMEVDGD-DFDITIPSDTDFLIARSTTDGHVSYRK 283

  Fly   261 TTRGSWFMQSLCAELAAN---GKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIP 316
            ...||||:||||..|..:   |  .||||:|..|...|::.         .:| .||:|
Zfish   284 PDEGSWFIQSLCRNLEKHCPLG--ADILTILLSVNNEVSIQ---------GLH-SKQMP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DriceNP_524551.2 CASc 86..330 CDD:214521 88/249 (35%)
casp20NP_001129724.1 CARD 10..82 CDD:260018
CASc 106..343 CDD:237997 88/249 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.