DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and RDH16

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_003699.3 Gene:RDH16 / 8608 HGNCID:29674 Length:317 Species:Homo sapiens


Alignment Length:301 Identity:84/301 - (27%)
Similarity:145/301 - (48%) Gaps:34/301 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLEPD 93
            |.|||||||.|..:|... ::..:.|::.|  :..:||:.|:|..|     .|:.|:.||:.:.:
Human    32 VFITGCDSGFGKLLARQL-DARGLRVLAAC--LTEKGAEQLRGQTS-----DRLETVTLDVTKTE 88

  Fly    94 SIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQ-IEAQINCNLLGTMRLTHELLP 157
            |:....:.:::.: :|..  |..|:||||:.........||:| ....::.||||.:.:|..|||
Human    89 SVAAAAQWVKECV-RDKG--LWGLVNNAGISLPTAPNELLTKQDFVTILDVNLLGVIDVTLSLLP 150

  Fly   158 LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNFIPGSFVLDSN 222
            |:|:.:||::||:|..|..:|.. |.|..||..:..::||||.||..:|::|....||.|   ..
Human   151 LVRRARGRVVNVSSVMGRVSLFG-GGYCISKYGVEAFSDSLRRELSYFGVKVAMIEPGYF---KT 211

  Fly   223 IAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVLSGFKPPNRLRNESLLAKFKDALTSSQP 287
            ....:::..:...|.:......:.:.|.|.|      ::.:| .:..:.|....:....:|:...
Human   212 AVTSKERFLKSFLEIWDRSSPEVKEAYGEKF------VADYK-KSAEQMEQKCTQDLSLVTNCME 269

  Fly   288 LALYIEEPR-RY------RLYRWLFTLCPTPLVD----WLT 317
            .||....|| ||      :|.....:..||.|||    |::
Human   270 HALIACHPRTRYSAGWDAKLLYLPMSYMPTFLVDAIMYWVS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 77/278 (28%)
adh_short 28..229 CDD:278532 64/200 (32%)
RDH16NP_003699.3 NADB_Rossmann 30..305 CDD:304358 83/294 (28%)
adh_short 30..218 CDD:278532 64/200 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.