DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and AYR1

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_012142.3 Gene:AYR1 / 854682 SGDID:S000001386 Length:297 Species:Saccharomyces cerevisiae


Alignment Length:280 Identity:66/280 - (23%)
Similarity:120/280 - (42%) Gaps:39/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLA--SAKDGLSRM 82
            :|:...:.:.::||...|:|:.:......:.:: |.:|        |:.|:.:|  :.:.|...:
Yeast     3 ELQSQPKKIAVVTGASGGIGYEVTKELARNGYL-VYAC--------ARRLEPMAQLAIQFGNDSI 58

  Fly    83 HTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCNLLG 147
            ...:||:.:|:.|......||   |..|..:|..|.||||..|...........:|.....|:.|
Yeast    59 KPYKLDISKPEEIVTFSGFLR---ANLPDGKLDLLYNNAGQSCTFPALDATDAAVEQCFKVNVFG 120

  Fly   148 TMRLTHELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNF 212
            .:.:..||...|.:.:|.|:...|..|:.:.|....|:|||||:..:...|.:|::.:.:.|:|.
Yeast   121 HINMCRELSEFLIKAKGTIVFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPFNVRVINA 185

  Fly   213 IPGSFVLDSNIAARQQ------QHAQKMREAFSAEQHALYDTYFEAFNGYLKVLSGFKPPNRLRN 271
            |.|....|  ||.::.      .:..:.||||::.:....|......:.|.|.|           
Yeast   186 ITGGVATD--IADKRPLPETSIYNFPEGREAFNSRKTMAKDNKPMPADAYAKQL----------- 237

  Fly   272 ESLLAKFKDALTSSQPLALY 291
                  .||.|::|.|:.:|
Yeast   238 ------VKDILSTSDPVDVY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 65/273 (24%)
adh_short 28..229 CDD:278532 51/208 (25%)
AYR1NP_012142.3 17beta-HSD-like_SDR_c 10..256 CDD:187632 65/273 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.