DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and TDA5

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_013530.1 Gene:TDA5 / 851146 SGDID:S000004418 Length:326 Species:Saccharomyces cerevisiae


Alignment Length:300 Identity:65/300 - (21%)
Similarity:115/300 - (38%) Gaps:72/300 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRRSLGLGRQQLKVDSRHVVLITGCDSGLGHS-MAVYCHESLHMTVIS---CCHNIKSEGAKLLQ 70
            ::||..:..:.|:.....:|||||...|||.: ::....:..::|:::   |..::::       
Yeast    54 IKRSGQVAWKSLREFKNGIVLITGGSKGLGRAIVSQLLQDYSNLTILNVDICPSSVRN------- 111

  Fly    71 GLASAKDGLSRMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMC-FGEFEWQLT 134
                     :|:..|..||.:.:.:    ..|.::|.:.....:..::|||||.. |..|.....
Yeast   112 ---------TRVKDLICDLSDDEEV----AALLNLLKRKYKNEIRLIVNNAGVRANFTGFNGMER 163

  Fly   135 EQIEAQINCNLLGTMRLTHELLPLLRQ-QQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSL 198
            :.::.....|....::...||.|.... :|..|:|:.|..|:.....:..||||||||..:..|.
Yeast   164 DNLDKIFKINTFAPLQFIQELAPSRHSTRQCYIVNIASILGILTPAKVAAYAASKAALIAFHQSY 228

  Fly   199 RVELQQYGMEVVNFI---PGSFVLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVL 260
            ..|||..|:..:..:   ||                |...|.|                      
Yeast   229 SFELQNEGVRNIRTLLVTPG----------------QLNTEMF---------------------- 255

  Fly   261 SGFKPPNRLRNESLLAKFKDALTSSQPLALYIEEPRRYRL 300
            :|||||.:     ..|...|..|.:..:..|.|..:|.:|
Yeast   256 AGFKPPRQ-----FFAPVIDITTLAAKIVRYCELGQRGQL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 61/281 (22%)
adh_short 28..229 CDD:278532 47/209 (22%)
TDA5NP_013530.1 NADB_Rossmann 72..309 CDD:419666 61/281 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S2670
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.