DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and AT5G65205

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_569008.1 Gene:AT5G65205 / 836644 AraportID:AT5G65205 Length:285 Species:Arabidopsis thaliana


Alignment Length:261 Identity:77/261 - (29%)
Similarity:116/261 - (44%) Gaps:54/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DSRHVVLITGC-DSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLEL 87
            |...||||||| ..|:||::|      ...:...|.....|...|.:..|  .||  |:....||
plant     6 DETPVVLITGCSQGGIGHALA------REFSANGCRVVATSRSQKTMTEL--EKD--SKFFVQEL 60

  Fly    88 DLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCNLLGTMRLT 152
            |:....|:..|..::.|...     ::..|:|||||.|.|.........::...|.|:||:||:|
plant    61 DVQSEQSVSKVVSKVIDKFG-----QIDVLVNNAGVQCIGPLAEIPISAMDYTFNTNVLGSMRMT 120

  Fly   153 HELLP-LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNFIPGS 216
            ..::| :..:::|:|:|:.|...:...|..|.|.||||||...||:||:||:.:|::|:|.:||.
plant   121 QAVVPHMASKKKGKIVNIGSISIMAPGPWAGVYTASKAALHALTDTLRLELKPFGIDVINIVPGG 185

  Fly   217 FVLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVLSGFKPPNRLRNESLLAKFKDA 281
              :.||||.                                   ||....|.|....|...|:||
plant   186 --IQSNIAN-----------------------------------SGISSFNNLPELKLYKPFEDA 213

  Fly   282 L 282
            :
plant   214 I 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 76/258 (29%)
adh_short 28..229 CDD:278532 68/202 (34%)
AT5G65205NP_569008.1 17beta-HSD-like_SDR_c 10..252 CDD:187632 76/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3446
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.