DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and HSD6

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_199890.1 Gene:HSD6 / 835149 AraportID:AT5G50770 Length:342 Species:Arabidopsis thaliana


Alignment Length:203 Identity:57/203 - (28%)
Similarity:95/203 - (46%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VVLITGCDSGLGHSMAV-YCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLE 91
            ||:|||..||:|.::|. |.....::.::    :|:.|....:..||... |...:..|..|:.:
plant    49 VVVITGAASGIGEALAYEYGKRGAYLALV----DIRGEPLFHVAALAELY-GSPEVLPLVADVSK 108

  Fly    92 -PDSIRLVHRQLRDILAKDPSYRLTALINNAGV---MCFGEFEWQLTEQIEAQINCNLLGTMRLT 152
             .|..|.:...:...      .||..|:.||||   ..|.:.|  ...:....::.|..|::..|
plant   109 LQDCERFIRATVLHF------GRLDHLVTNAGVAPLYFFADIE--DVSKASPAMDINFWGSVYCT 165

  Fly   153 HELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVEL-QQYGMEVVNFIPGS 216
            ....|.|::.:|||:.:.|.||..|.|.|..|.|||||:..:.::||.|. ...|:.:|  .|| 
plant   166 FFASPYLKKFRGRIVVIASGCGYIASPRLSFYCASKAAVIAFYETLRTEFGSDIGVTIV--APG- 227

  Fly   217 FVLDSNIA 224
             ::||.::
plant   228 -IVDSEMS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 57/203 (28%)
adh_short 28..229 CDD:278532 57/203 (28%)
HSD6NP_199890.1 NADB_Rossmann 45..305 CDD:304358 57/203 (28%)
PRK06181 47..307 CDD:235726 57/203 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.