DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and TSC10B

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_197421.1 Gene:TSC10B / 832040 AraportID:AT5G19200 Length:331 Species:Arabidopsis thaliana


Alignment Length:209 Identity:57/209 - (27%)
Similarity:89/209 - (42%) Gaps:40/209 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKL------LQGLASAKDGL 79
            :.:..|| |.|||..||:|.::|               |...|||||:      .:.||.||..:
plant    33 IPIKFRH-VFITGGSSGIGLALA---------------HRAVSEGAKVSILARSTEKLAEAKRSI 81

  Fly    80 S-----RMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEA 139
            .     .:.|...|:.:.|::.         .|.|.|..:..||.|.||....|.|.|..|:::.
plant    82 QLATGVEVATFSADVRDYDAVS---------KAIDESGPIDVLIVNQGVFIGKELEKQSPEEVKF 137

  Fly   140 QINCNLLGTMRLTHELLPLLRQQQGR----IINVTSHCGLQALPALGPYAASKAALRFWTDSLRV 200
            .|:.||.|:..:....||.::.::||    |..|:|..|...:.....|:|||..|:....:|:.
plant   138 MIDVNLTGSFNVIKAALPAMKAREGRGPASISLVSSQAGQAGIYGYTAYSASKFGLQGLAQALQQ 202

  Fly   201 ELQQYGMEVVNFIP 214
            |:...|:.|....|
plant   203 EVISDGIHVTLLFP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 56/203 (28%)
adh_short 28..229 CDD:278532 55/202 (27%)
TSC10BNP_197421.1 KDSR-like_SDR_c 38..271 CDD:187643 57/204 (28%)
adh_short 38..222 CDD:278532 57/204 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.