DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and AT5G10050

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_196567.2 Gene:AT5G10050 / 830869 AraportID:AT5G10050 Length:279 Species:Arabidopsis thaliana


Alignment Length:231 Identity:74/231 - (32%)
Similarity:112/231 - (48%) Gaps:25/231 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DSRHVVLITGC-DSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLEL 87
            |...||||||| ..|:||::|      ...|...|.....|.....:..|...    ||:...||
plant     5 DESPVVLITGCSQGGIGHALA------REFTEKGCRVVATSRSRSTMTDLEQD----SRLFVKEL 59

  Fly    88 DLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCNLLGTMRLT 152
            |:....::..|..::.|...|     :..|:|||||.|.|.........:|...|.|:.|:||:|
plant    60 DVQSDQNVSKVLSEVIDKFGK-----IDVLVNNAGVQCVGPLAETPISAMENTFNTNVFGSMRMT 119

  Fly   153 HELLP-LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNFIPGS 216
            ..::| ::.:::|:|:||.|...:...|..|.|.|:|||:...||:||:||:.:|::|:|.:||.
plant   120 QAVVPHMVSKKKGKIVNVGSITVMAPGPWAGVYTATKAAIHALTDTLRLELRPFGIDVINVVPGG 184

  Fly   217 FVLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEA 252
              :.:|||........||.|.      .||..|.||
plant   185 --IRTNIANSAVATFNKMPEL------KLYKPYEEA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 73/228 (32%)
adh_short 28..229 CDD:278532 65/202 (32%)
AT5G10050NP_196567.2 17beta-HSD-like_SDR_c 9..254 CDD:187632 73/227 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3446
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.