DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and TSC10A

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001325788.1 Gene:TSC10A / 819779 AraportID:AT3G06060 Length:343 Species:Arabidopsis thaliana


Alignment Length:326 Identity:75/326 - (23%)
Similarity:124/326 - (38%) Gaps:76/326 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLL------QGLASAKDG 78
            ::.:.||| ..|||..||:|.::|               |...||||::.      ..|..||..
plant    51 KIPIKSRH-AFITGGSSGIGLALA---------------HRAASEGARVSILARSGSKLEEAKKS 99

  Fly    79 LS-----RMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIE 138
            :.     .:.|...|:.:.|::.         .|.|.|..:..||.|.||....|......|.::
plant   100 IQLATGVEVATFSADVRDYDAVS---------KAIDESGPIDVLIVNQGVFTAKELVKHSPEDVK 155

  Fly   139 AQINCNLLGTMRLTHELLPLLRQQQGR----IINVTSHCGLQALPALGPYAASKAALRFWTDSLR 199
            ..|:.||:|:..:....||.::.::.|    |..|:|..|...:.....|:|||..|:....:|:
plant   156 FTIDVNLVGSFNVIKAALPAMKARKDRGPASISLVSSQAGQVGVYGYAAYSASKFGLQGLAQALQ 220

  Fly   200 VELQQYGMEVVNFIPGSFVLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYL------- 257
            .|:....:.|....|.    |:|....:::  ||.|...:|        ...|.:|.:       
plant   221 QEVISDDIHVTLIFPP----DTNTPGFEEE--QKSRPEVTA--------IIAASSGSMETEEVAK 271

  Fly   258 KVLSGFKPPNRLRNESLLAKFKDALTSSQPLALYIEEPRR--YRLYRWLFTLCPTPLV------D 314
            |.:.|.|    ..|.::...|:..|.|   ||.....|:|  :..:..:.|..|..|:      |
plant   272 KAMDGIK----AGNFTVSCNFEGFLLS---LATTGMSPQRSFWLAFLEVITAGPIRLIALFFQWD 329

  Fly   315 W 315
            |
plant   330 W 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 68/296 (23%)
adh_short 28..229 CDD:278532 50/215 (23%)
TSC10ANP_001325788.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.