DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and zmp:0000001048

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_005163825.1 Gene:zmp:0000001048 / 556557 ZFINID:ZDB-GENE-140106-8 Length:310 Species:Danio rerio


Alignment Length:306 Identity:79/306 - (25%)
Similarity:131/306 - (42%) Gaps:55/306 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLEPD 93
            ||:|||.||:|.::||               .:..:..:..:.:|:.:| |.|...||....|..
Zfish     6 VLVTGCSSGIGLAVAV---------------RLAKDELRRFKVVATMRD-LDRREALERAAGETL 54

  Fly    94 SIRLVHRQL--------RDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCNLLGTMR 150
            :..|..|||        ||.:...|..::..|:|||||...|..|.|....::...|.|..|.:|
Zfish    55 NRSLEIRQLDATCEDSIRDCVNSLPDRQVDVLVNNAGVGMIGPLECQSMSSMQDLFNTNFFGLVR 119

  Fly   151 LTHELLPLLRQQQ-GRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNFIP 214
            |..||||.::::| |.||.::|..|:|.|.....|||||.|:..:.:||.|:..::.:::....|
Zfish   120 LVKELLPQMKKRQSGHIIVMSSVLGIQGLLFNDLYAASKFAVEGFCESLAVQAMKFNVKMTLVEP 184

  Fly   215 GSFVLD-----------SNIAARQQQHAQKMREAFSAEQ----HALYDTYFEAFNGYLKVLSGFK 264
            |..|.:           .:::...::.||..|:.:....    |::..|..|......:::....
Zfish   185 GPVVTEFERKVYEEAETMDLSETDEETAQIFRQIYLPYSRRVFHSIGQTPEEVAEQTTRLILSKN 249

  Fly   265 PP-----NRLRNESLLAKFKDALTSSQPLALYIEEPRRYRLYRWLF 305
            ||     |||.......|..|. |...|:..:         |:.:|
Zfish   250 PPFRHQTNRLYMPLTAMKHADP-TGRLPIDAF---------YKMIF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 77/299 (26%)
adh_short 28..229 CDD:278532 62/219 (28%)
zmp:0000001048XP_005163825.1 NADB_Rossmann 4..260 CDD:304358 72/269 (27%)
adh_short 4..198 CDD:278532 62/207 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.