DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and rdh5

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001025272.1 Gene:rdh5 / 556528 ZFINID:ZDB-GENE-050208-411 Length:328 Species:Danio rerio


Alignment Length:316 Identity:83/316 - (26%)
Similarity:130/316 - (41%) Gaps:49/316 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RQQLK---VDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLLQGLASAK--D 77
            |..||   |..:| |.:||||||.|:.:               |..:...|.::|.|..:.|  |
Zfish    29 RDNLKITRVSEKH-VFVTGCDSGFGNLL---------------CKRLDKRGFRVLAGCLTEKGAD 77

  Fly    78 GLSR-----MHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAG-VMCFGEFEWQLTEQ 136
            .|.|     :.|..||:....||:......::.:.   ...|..|:|||| .:..|..||...|.
Zfish    78 DLKRAAGPFLKTCILDVTSSASIQKAMEWTKNEVG---DKGLWGLVNNAGRSLPMGPSEWMKIED 139

  Fly   137 IEAQINCNLLGTMRLTHELLPLLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVE 201
            .|:.:..|:.|.:..|...|||:::.:|||:||.|..|..|... |.|..||.|:..::|.||.:
Zfish   140 FESTLKVNMTGVIETTMTFLPLVKKARGRIVNVASVLGRVAANG-GGYCISKFAVESFSDCLRRD 203

  Fly   202 LQQYGMEVVNFIPGSFVLDSNIAARQQQHAQKMREAFSAEQHALY-DTYFEAFNGYLKVLSGFKP 265
            :|.:|:.|....||.|..........::...::....:.|....| |.|.:.   |:.:      
Zfish   204 IQGFGVNVCIIEPGFFKTQVTSLEPIERELHRLWNQLTPEVKESYGDKYLDK---YIWI------ 259

  Fly   266 PNRLRNESLLAKFKDALTSSQPLALYIEEPR-RYRL-----YRWL-FTLCPTPLVD 314
             .||...::.......:|:....||....|| ||..     :.|: .:..|...||
Zfish   260 -QRLIMNAICDSDLSKVTNCMEHALLAVHPRTRYSAGWDAKFLWIPLSYMPACFVD 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 75/282 (27%)
adh_short 28..229 CDD:278532 60/208 (29%)
rdh5NP_001025272.1 NADB_Rossmann 40..314 CDD:304358 77/303 (25%)
adh_short 40..224 CDD:278532 61/203 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.