DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and rdh7

DIOPT Version :9

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001017189.1 Gene:rdh7 / 549943 XenbaseID:XB-GENE-1194363 Length:318 Species:Xenopus tropicalis


Alignment Length:309 Identity:94/309 - (30%)
Similarity:147/309 - (47%) Gaps:34/309 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RQQLKVDSRHVVLITGCDSGLGHSMAVYCHE-SLHMTVISCCHNIKSEGAKLLQGLASAKDGLSR 81
            ||.||..:...|||||||||.|:.:|....: .:|  |::.|  :..:||:.|:     |:..||
 Frog    21 RQILKNLTDKYVLITGCDSGFGNLLARQLDKRGIH--VLAAC--LTDKGAQDLK-----KETSSR 76

  Fly    82 MHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGV-MCFGEFEWQLTEQIEAQINCNL 145
            :.|:.||:.:..|:..|...:..|:.   :..|..|:||||| :.....||...|.....:|.||
 Frog    77 LQTVILDVTDSKSVCSVANWVSSIVG---NKGLWGLVNNAGVSVPSAPNEWLTKEDFLKILNVNL 138

  Fly   146 LGTMRLTHELLPLLRQQQGRIINVTS------HCGLQALPALGPYAASKAALRFWTDSLRVELQQ 204
            ||.:.:|.:|||.:|:.:||::||.|      .||       |.|..||..:..::||||.|:..
 Frog   139 LGVIDVTIKLLPQVRKAKGRVVNVASIAGRLTFCG-------GGYCMSKYGVESFSDSLRHEMAP 196

  Fly   205 YGMEVVNFIPGSFVLDSNIAARQQQHAQKMREAFSAEQHALY-DTYFEAFNGYLKV-LSGFKPPN 267
            :|::|....||.|......|..|::|.||:......|....| ..|::.:...:.: |:...|..
 Frog   197 FGVKVCMVEPGFFKTQVTDARLQKEHLQKIWHGLPEEIRKSYGQQYYDKYCSNVDLSLARSNPKL 261

  Fly   268 RLRNESLLAKFKDALTSSQPLALYIEEPRRYRLYRWLFTLCPTPLVDWL 316
            .|..:.:    :.|||:..|...|........||..|..| |...||::
 Frog   262 HLVTDCM----EHALTAECPKTRYTAGLDAKLLYIPLSYL-PAAFVDFI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 83/282 (29%)
adh_short 28..229 CDD:278532 69/208 (33%)
rdh7NP_001017189.1 NADB_Rossmann 30..306 CDD:304358 90/300 (30%)
adh_short 30..221 CDD:278532 69/209 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 1 1.000 - - FOG0000161
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.