DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sro and dmtn

DIOPT Version :10

Sequence 1:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_012814412.1 Gene:dmtn / 548579 XenbaseID:XB-GENE-982208 Length:416 Species:Xenopus tropicalis


Alignment Length:62 Identity:16/62 - (25%)
Similarity:26/62 - (41%) Gaps:17/62 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SEGAKLLQGLASAKDGLSRMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVM 124
            :.||:  .|.:|.:.|:...|..||...||           ::..|.|.|||    ..:|::
 Frog   115 AHGAR--GGTSSPRGGVQHFHCPELSQAEP-----------NLYKKPPIYRL----KESGIL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 16/62 (26%)
dmtnXP_012814412.1 AbLIM_anchor 8..366 CDD:465046 16/62 (26%)
VHP 381..416 CDD:460493
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.